SCOPe 2.08: Domain d1lk3h2: 1lk3 H:120-219

Lineage for d1lk3h2 (1lk3 H:120-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries)

8. Domain d1lk3h2: 1lk3 H:120-219 [73953]
   Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3i1, d1lk3l1, d1lk3l2, d1lk3m1, d1lk3m2
   part of anti-IL-10 Fab 9D7

Details for d1lk3h2

PDB Entry: 1lk3, 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

PDB Compounds: (H:) 9D7 Heavy Chain

SCOPe Domain Sequences for d1lk3h2:

Sequence; same for both SEQRES and ATOM records:

>d1lk3h2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aettapsvyplapgtalksnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg
lytltssvtvpsstwpsqtvtcnvahpasstkvdkkivpr

Timeline for d1lk3h2:

• d1lk3h2 first appeared in SCOP 1.61
  
• d1lk3h2 appears in SCOPe 2.07