SCOPe 2.04: Domain d1lk3h1: 1lk3 H:1-119

Lineage for d1lk3h1 (1lk3 H:1-119)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1lk3h1: 1lk3 H:1-119 [73952]
   Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h2, d1lk3i2, d1lk3l1, d1lk3l2, d1lk3m1, d1lk3m2
   part of anti-IL-10 Fab 9D7

Details for d1lk3h1

PDB Entry: 1lk3, 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

PDB Compounds: (H:) 9D7 Heavy Chain

SCOPe Domain Sequences for d1lk3h1:

Sequence; same for both SEQRES and ATOM records:

>d1lk3h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qvnllqsgaalvkpgasvklsckasgytftdfyihwvkqshgkslewigyinpnsgytny
nekfknkatltvdkststgymelsrltsedsanysctrgvpgnnwfpywgqgtlvtvss

Timeline for d1lk3h1:

• d1lk3h1 first appeared in SCOP 1.61
  
• d1lk3h1 appears in SCOPe 2.03
  
• d1lk3h1 appears in SCOPe 2.05
  
• d1lk3h1 appears in the current release, SCOPe 2.08