![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglments of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species) intertwined dimer, similar to interferon-gamma |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47307] (5 PDB entries) |
![]() | Domain d1lk3a_: 1lk3 A: [73950] Other proteins in same PDB: d1lk3h1, d1lk3h2, d1lk3i1, d1lk3i2, d1lk3l1, d1lk3l2, d1lk3m1, d1lk3m2 |
PDB Entry: 1lk3 (more details), 1.91 Å
SCOP Domain Sequences for d1lk3a_:
Sequence, based on SEQRES records: (download)
>d1lk3a_ a.26.1.3 (A:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens)} nmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqfyleevmpqa enqdpdikahvnslgenlktlrlrlrrchrflpcengggsggkskaveqvknafnklqek giykamsefdifinyieaymtmk
>d1lk3a_ a.26.1.3 (A:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens)} nmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqfyleevmpqa enqdpdikahvnslgenlktlrlrlrrchrflpcekskaveqvknafnklqekgiykams efdifinyieaymtmk
Timeline for d1lk3a_: