SCOP 1.73: Domain d1lk0b_: 1lk0 B:

Lineage for d1lk0b_ (1lk0 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Arsenate reductase ArsC [69504] (3 species)
   also has a phosphotyrosine phosphatase activity

7. Species Staphylococcus aureus [TaxId:1280] [69505] (8 PDB entries)

8. Domain d1lk0b_: 1lk0 B: [73949]
   complexed with cl, k; mutant

Details for d1lk0b_

PDB Entry: 1lk0, 1.6 Å

PDB Description: disulfide intermediate of c89l arsenate reductase from pi258

PDB Compounds: (B:) arsenate reductase

SCOP Domain Sequences for d1lk0b_:

Sequence; same for both SEQRES and ATOM records:

>d1lk0b_ c.44.1.1 (B:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]}
dkktiyfictgnscrsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidisn
htsdlidndilkqsdlvvtlcsdadnnlpilppnvkkehwgfddpagkewsefqrvrdei
klaiekfklr

Timeline for d1lk0b_:

• d1lk0b_ first appeared in SCOP 1.61
  
• d1lk0b_ appears in SCOP 1.71
  
• d1lk0b_ appears in SCOP 1.75
  
• d1lk0b_ appears in the current release, SCOPe 2.08