Lineage for d1lk0b_ (1lk0 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584193Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 584194Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 584195Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 584196Protein Arsenate reductase ArsC [69504] (3 species)
    also has a phosphotyrosine phosphatase activity
  7. 584207Species Staphylococcus aureus [TaxId:1280] [69505] (7 PDB entries)
  8. 584212Domain d1lk0b_: 1lk0 B: [73949]
    complexed with cl, k; mutant

Details for d1lk0b_

PDB Entry: 1lk0 (more details), 1.6 Å

PDB Description: disulfide intermediate of c89l arsenate reductase from pi258

SCOP Domain Sequences for d1lk0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk0b_ c.44.1.1 (B:) Arsenate reductase ArsC {Staphylococcus aureus}
dkktiyfictgnscrsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidisn
htsdlidndilkqsdlvvtlcsdadnnlpilppnvkkehwgfddpagkewsefqrvrdei
klaiekfklr

SCOP Domain Coordinates for d1lk0b_:

Click to download the PDB-style file with coordinates for d1lk0b_.
(The format of our PDB-style files is described here.)

Timeline for d1lk0b_: