SCOP 1.71: Domain d1lk0a_: 1lk0 A:

Lineage for d1lk0a_ (1lk0 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Arsenate reductase ArsC [69504] (3 species)
   also has a phosphotyrosine phosphatase activity

7. Species Staphylococcus aureus [TaxId:1280] [69505] (7 PDB entries)

8. Domain d1lk0a_: 1lk0 A: [73948]

Details for d1lk0a_

PDB Entry: 1lk0, 1.6 Å

PDB Description: disulfide intermediate of c89l arsenate reductase from pi258

SCOP Domain Sequences for d1lk0a_:

Sequence; same for both SEQRES and ATOM records:

>d1lk0a_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus}
dkktiyfictgnscrsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidisn
htsdlidndilkqsdlvvtlcsdadnnlpilppnvkkehwgfddpagkewsefqrvrdei
klaiekfklr

Timeline for d1lk0a_:

• d1lk0a_ first appeared in SCOP 1.61
  
• d1lk0a_ appears in SCOP 1.69
  
• d1lk0a_ appears in SCOP 1.73
  
• d1lk0a_ appears in the current release, SCOPe 2.08