SCOP 1.67: Domain d1ljua_: 1lju A:

Lineage for d1ljua_ (1lju A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Arsenate reductase ArsC [69504] (2 species)
   also has a phosphotyrosine phosphatase activity

7. Species Staphylococcus aureus [TaxId:1280] [69505] (5 PDB entries)

8. Domain d1ljua_: 1lju A: [73944]
   complexed with csr, k; mutant

Details for d1ljua_

PDB Entry: 1lju, 1.4 Å

PDB Description: x-ray structure of c15a arsenate reductase from pi258 complexed with arsenite

SCOP Domain Sequences for d1ljua_:

Sequence; same for both SEQRES and ATOM records:

>d1ljua_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus}
mdkktiyfictgnsarsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidis
nhtsdlidndilkqsdlvvtlcsdadnncpilppnvkkehwgfddpagkewsefqrvrde
iklaiekfklr

Timeline for d1ljua_:

• d1ljua_ first appeared in SCOP 1.61
  
• d1ljua_ appears in SCOP 1.65
  
• d1ljua_ appears in SCOP 1.69
  
• d1ljua_ appears in the current release, SCOPe 2.08