SCOPe 2.07: Domain d1ljoa1: 1ljo A:3-75

Lineage for d1ljoa1 (1ljo A:3-75)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein Archaeal homoheptameric Sm protein [63758] (6 species)

7. Species Archaeoglobus fulgidus, AF-Sm2 [TaxId:2234] [74938] (1 PDB entry)

8. Domain d1ljoa1: 1ljo A:3-75 [73941]
   Other proteins in same PDB: d1ljoa2
   complexed with acy, cd

Details for d1ljoa1

PDB Entry: 1ljo, 1.95 Å

PDB Description: crystal structure of an sm-like protein (af-sm2) from archaeoglobus fulgidus at 1.95a resolution

PDB Compounds: (A:) Archaeal Sm-like protein AF-Sm2

SCOPe Domain Sequences for d1ljoa1:

Sequence; same for both SEQRES and ATOM records:

>d1ljoa1 b.38.1.1 (A:3-75) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]}
mvlpnqmvksmvgkiirvemkgeenqlvgklegvddymnlyltnameckgeekvrslgei
vlrgnnvvliqpq

Timeline for d1ljoa1:

• d1ljoa1 first appeared in SCOP 1.61, called d1ljoa_
  
• d1ljoa1 appears in SCOPe 2.06
  
• d1ljoa1 appears in the current release, SCOPe 2.08