Lineage for d1ljoa_ (1ljo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786640Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1786641Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1786685Species Archaeoglobus fulgidus, AF-Sm2 [TaxId:2234] [74938] (1 PDB entry)
  8. 1786686Domain d1ljoa_: 1ljo A: [73941]
    complexed with acy, cd

Details for d1ljoa_

PDB Entry: 1ljo (more details), 1.95 Å

PDB Description: crystal structure of an sm-like protein (af-sm2) from archaeoglobus fulgidus at 1.95a resolution
PDB Compounds: (A:) Archaeal Sm-like protein AF-Sm2

SCOPe Domain Sequences for d1ljoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]}
gamvlpnqmvksmvgkiirvemkgeenqlvgklegvddymnlyltnameckgeekvrslg
eivlrgnnvvliqpq

SCOPe Domain Coordinates for d1ljoa_:

Click to download the PDB-style file with coordinates for d1ljoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ljoa_: