SCOPe 2.05: Domain d1ljna_: 1ljn A:

Lineage for d1ljna_ (1ljn A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d1ljna_: 1ljn A: [73940]
   complexed with cbs, so4

Details for d1ljna_

PDB Entry: 1ljn, 1.19 Å

PDB Description: crystal structure of turkey egg lysozyme complex with di-n- acetylchitobiose at 1.19a resolution

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1ljna_:

Sequence; same for both SEQRES and ATOM records:

>d1ljna_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

Timeline for d1ljna_:

• d1ljna_ first appeared in SCOP 1.61
  
• d1ljna_ appears in SCOPe 2.04
  
• d1ljna_ appears in SCOPe 2.06
  
• d1ljna_ appears in the current release, SCOPe 2.08