Lineage for d1ljna_ (1ljn A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (16 species) 
Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (12 PDB entries) 
Domain d1ljna_: 1ljn A: [73940]
Details for d1ljna_
PDB Entry: 1ljn (more details), 1.19 Å
PDB Description: crystal structure of turkey egg lysozyme complex with di-n- acetylchitobiose at 1.19a resolution
SCOP Domain Sequences for d1ljna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljna_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl
SCOP Domain Coordinates for d1ljna_:
Click to download the PDB-style file with coordinates for d1ljna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ljna_:
- d1ljna_ is new in SCOP 1.61
- d1ljna_ appears in SCOP 1.63
- d1ljna_ appears in the current release, SCOPe 2.08
View in 3D