Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) automatically mapped to Pfam PF01451 |
Protein Arsenate reductase ArsC [69504] (3 species) also has a phosphotyrosine phosphatase activity |
Species Staphylococcus aureus [TaxId:1280] [69505] (8 PDB entries) Uniprot P30330 |
Domain d1ljla_: 1ljl A: [73939] complexed with k |
PDB Entry: 1ljl (more details), 2.01 Å
SCOPe Domain Sequences for d1ljla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljla_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]} dkktiyfictgnscrsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidisn htsdlidndilkqsdlvvtlcsdadnncpilppnvkkehwgfddpagkewsefqrvrdei klaiekfklr
Timeline for d1ljla_: