Lineage for d1ljla_ (1ljl A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315095Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 315096Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 315097Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 315098Protein Arsenate reductase ArsC [69504] (2 species)
    also has a phosphotyrosine phosphatase activity
  7. 315104Species Staphylococcus aureus [TaxId:1280] [69505] (5 PDB entries)
  8. 315109Domain d1ljla_: 1ljl A: [73939]
    complexed with k

Details for d1ljla_

PDB Entry: 1ljl (more details), 2.01 Å

PDB Description: wild type pi258 s. aureus arsenate reductase

SCOP Domain Sequences for d1ljla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljla_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus}
dkktiyfictgnscrsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidisn
htsdlidndilkqsdlvvtlcsdadnncpilppnvkkehwgfddpagkewsefqrvrdei
klaiekfklr

SCOP Domain Coordinates for d1ljla_:

Click to download the PDB-style file with coordinates for d1ljla_.
(The format of our PDB-style files is described here.)

Timeline for d1ljla_: