Lineage for d1ljla_ (1ljl A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) 
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins) Protein Arsenate reductase ArsC [69504] (2 species) Species Staphylococcus aureus [TaxId:1280] [69505] (5 PDB entries) 
Domain d1ljla_: 1ljl A: [73939]
Details for d1ljla_
PDB Entry: 1ljl (more details), 2.01 Å
PDB Description: wild type pi258 s. aureus arsenate reductase
SCOP Domain Sequences for d1ljla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljla_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus}
dkktiyfictgnscrsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidisn
htsdlidndilkqsdlvvtlcsdadnncpilppnvkkehwgfddpagkewsefqrvrdei
klaiekfklr
SCOP Domain Coordinates for d1ljla_:
Click to download the PDB-style file with coordinates for d1ljla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ljla_:
- d1ljla_ is new in SCOP 1.61
- d1ljla_ appears in SCOP 1.63
- d1ljla_ appears in the current release, SCOPe 2.08
View in 3D