Lineage for d1lj7g_ (1lj7 G:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164914Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 164915Protein C-reactive protein (CRP) [49954] (1 species)
  7. 164916Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries)
  8. 164928Domain d1lj7g_: 1lj7 G: [73935]

Details for d1lj7g_

PDB Entry: 1lj7 (more details), 3.15 Å

PDB Description: crystal structure of calcium-depleted human c-reactive protein from perfectly twinned data

SCOP Domain Sequences for d1lj7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj7g_ b.29.1.5 (G:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1lj7g_:

Click to download the PDB-style file with coordinates for d1lj7g_.
(The format of our PDB-style files is described here.)

Timeline for d1lj7g_: