SCOPe 2.08: Domain d1lj2b_: 1lj2 B:

Lineage for d1lj2b_ (1lj2 B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families)
   not a true superfamily

5. Family h.1.13.2: NSP3 C-terminal domain, NS34 [75699] (1 protein)

6. Protein NSP3 C-terminal domain, NS34 [75700] (1 species)

7. Species Simian rotavirus, SA11 [TaxId:10922] [75701] (1 PDB entry)

8. Domain d1lj2b_: 1lj2 B: [73927]
   complexed with eIF4G peptide, chains C and D
   protein/RNA complex; complexed with au

Details for d1lj2b_

PDB Entry: 1lj2, 2.38 Å

PDB Description: recognition of eif4g by rotavirus nsp3 reveals a basis for mrna circularization

PDB Compounds: (B:) Nonstructural RNA-binding Protein 34

SCOPe Domain Sequences for d1lj2b_:

Sequence; same for both SEQRES and ATOM records:

>d1lj2b_ h.1.13.2 (B:) NSP3 C-terminal domain, NS34 {Simian rotavirus, SA11 [TaxId: 10922]}
mhslqnvipqqqahiaelqvynnklerdlqnkigsltssiewylrsmeldpeikadieqq
insidainplhafddlesvirnlisdydklflmfkgliqrsnyqysfgse

Timeline for d1lj2b_:

• d1lj2b_ first appeared in SCOP 1.61
  
• d1lj2b_ appears in SCOPe 2.07