Class a: All alpha proteins [46456] (284 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Cysteinyl-tRNA synthetase (CysRS) [74709] (1 species) contains extra C-terminal alpha+beta subdomain: [alpha(2)-beta(2)], ordered in the complex with tRNA |
Species Escherichia coli [TaxId:562] [74710] (3 PDB entries) Uniprot P21888; extra C-terminal subdomain: 407-461 |
Domain d1li7b1: 1li7 B:316-402 [73919] Other proteins in same PDB: d1li7a2, d1li7b2 complexed with cys, zn |
PDB Entry: 1li7 (more details), 2.6 Å
SCOP Domain Sequences for d1li7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1li7b1 a.27.1.1 (B:316-402) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} lerlytalrgtdktvapaggeafearfieamdddfntpeaysvlfdmarevnrlkaedma aanamashlrklsavlglleqepeafl
Timeline for d1li7b1: