Lineage for d1li7a2 (1li7 A:1-315)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105387Protein Cysteinyl-tRNA synthetase (CysRS) [75161] (1 species)
  7. 2105388Species Escherichia coli [TaxId:562] [75162] (3 PDB entries)
    Uniprot P21888
  8. 2105392Domain d1li7a2: 1li7 A:1-315 [73918]
    Other proteins in same PDB: d1li7a1, d1li7b1
    complexed with cys, zn

Details for d1li7a2

PDB Entry: 1li7 (more details), 2.6 Å

PDB Description: Crystal Structure of Cysteinyl-tRNA Synthetase with Cysteine Substrate Bound
PDB Compounds: (A:) cysteinyl-tRNA synthetase

SCOPe Domain Sequences for d1li7a2:

Sequence, based on SEQRES records: (download)

>d1li7a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
mlkifntltrqkeefkpihagevgmyvcgitvydlchighgrtfvafdvvarylrflgyk
lkyvrnitdiddkiikranengesfvamvdrmiaemhkdfdalnilrpdmeprathhiae
iielteqliakghayvadngdvmfdvptdptygvlsrqdldqlqagarvdvvddkrnpmd
fvlwkmskegepswpspwgagrpgwhiecsamnckqlgnhfdihgggsdlmfphheneia
qstcahdgqyvnywmhsgmvmvdrekmskslgnfftvrdvlkyydaetvryflmsghyrs
qlnyseenlkqaraa

Sequence, based on observed residues (ATOM records): (download)

>d1li7a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
mlkifntltrqkeefkpihagevgmyvcgitvydlchighgrtfvafdvvarylrflgyk
lkyvrnitdiddkiikranengesfvamvdrmiaemhkdfdalnilrpdmeprathhiae
iielteqliakghayvadngdvmfdvptdptygvlsrqkrnpmdfvlwkmskegepswps
pwgagrpgwhiecsamnckqlgnhfdihgggsdlmfphheneiaqstcahdgqyvnywmh
sgmvmvdrekmskslgnfftvrdvlkyydaetvryflmsghyrsqlnyseenlkqaraa

SCOPe Domain Coordinates for d1li7a2:

Click to download the PDB-style file with coordinates for d1li7a2.
(The format of our PDB-style files is described here.)

Timeline for d1li7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1li7a1