Lineage for d1li7a1 (1li7 A:316-402)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991851Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 protein domains)
  6. 1991859Protein Cysteinyl-tRNA synthetase (CysRS) [74709] (1 species)
    contains extra C-terminal alpha+beta subdomain: [alpha(2)-beta(2)], ordered in the complex with tRNA
  7. 1991860Species Escherichia coli [TaxId:562] [74710] (3 PDB entries)
    Uniprot P21888; extra C-terminal subdomain: 407-461
  8. 1991864Domain d1li7a1: 1li7 A:316-402 [73917]
    Other proteins in same PDB: d1li7a2, d1li7b2
    complexed with cys, zn

Details for d1li7a1

PDB Entry: 1li7 (more details), 2.6 Å

PDB Description: Crystal Structure of Cysteinyl-tRNA Synthetase with Cysteine Substrate Bound
PDB Compounds: (A:) cysteinyl-tRNA synthetase

SCOPe Domain Sequences for d1li7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li7a1 a.27.1.1 (A:316-402) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
lerlytalrgtdktvapaggeafearfieamdddfntpeaysvlfdmarevnrlkaedma
aanamashlrklsavlglleqepeafl

SCOPe Domain Coordinates for d1li7a1:

Click to download the PDB-style file with coordinates for d1li7a1.
(The format of our PDB-style files is described here.)

Timeline for d1li7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1li7a2