Lineage for d1li5b1 (1li5 B:316-402)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767290Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 767291Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 767292Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 767300Protein Cysteinyl-tRNA synthetase (CysRS) [74709] (1 species)
    contains extra C-terminal alpha+beta subdomain: [alpha(2)-beta(2)], ordered in the complex with tRNA
  7. 767301Species Escherichia coli [TaxId:562] [74710] (3 PDB entries)
    Uniprot P21888; extra C-terminal subdomain: 407-461
  8. 767303Domain d1li5b1: 1li5 B:316-402 [73914]
    Other proteins in same PDB: d1li5a2, d1li5b2
    complexed with zn

Details for d1li5b1

PDB Entry: 1li5 (more details), 2.3 Å

PDB Description: Crystal Structure of Cysteinyl-tRNA Synthetase
PDB Compounds: (B:) cysteinyl-tRNA synthetase

SCOP Domain Sequences for d1li5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li5b1 a.27.1.1 (B:316-402) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
lerlytalrgtdktvapaggeafearfieamdddfntpeaysvlfdmarevnrlkaedma
aanamashlrklsavlglleqepeafl

SCOP Domain Coordinates for d1li5b1:

Click to download the PDB-style file with coordinates for d1li5b1.
(The format of our PDB-style files is described here.)

Timeline for d1li5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1li5b2