Lineage for d1li5a1 (1li5 A:316-402)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316215Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2316216Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2316217Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 protein domains)
  6. 2316225Protein Cysteinyl-tRNA synthetase (CysRS) [74709] (1 species)
    contains extra C-terminal alpha+beta subdomain: [alpha(2)-beta(2)], ordered in the complex with tRNA
  7. 2316226Species Escherichia coli [TaxId:562] [74710] (3 PDB entries)
    Uniprot P21888; extra C-terminal subdomain: 407-461
  8. 2316228Domain d1li5a1: 1li5 A:316-402 [73912]
    Other proteins in same PDB: d1li5a2, d1li5b2
    complexed with zn

Details for d1li5a1

PDB Entry: 1li5 (more details), 2.3 Å

PDB Description: Crystal Structure of Cysteinyl-tRNA Synthetase
PDB Compounds: (A:) cysteinyl-tRNA synthetase

SCOPe Domain Sequences for d1li5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li5a1 a.27.1.1 (A:316-402) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
lerlytalrgtdktvapaggeafearfieamdddfntpeaysvlfdmarevnrlkaedma
aanamashlrklsavlglleqepeafl

SCOPe Domain Coordinates for d1li5a1:

Click to download the PDB-style file with coordinates for d1li5a1.
(The format of our PDB-style files is described here.)

Timeline for d1li5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1li5a2