SCOPe 2.03: Domain d1li1b2: 1li1 B:115-229

Lineage for d1li1b2 (1li1 B:115-229)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
   duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
   automatically mapped to Pfam PF01413

6. Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75587] (1 PDB entry)

8. Domain d1li1b2: 1li1 B:115-229 [73901]
   alpha 1 (chains A,B,D and E) and alpha 2 (chains C and F) isoforms
   complexed with act

Details for d1li1b2

PDB Entry: 1li1, 1.9 Å

PDB Description: The 1.9-A crystal structure of the noncollagenous (NC1) domain of human placenta collagen IV shows stabilization via a novel type of covalent Met-Lys cross-link

PDB Compounds: (B:) Collagen alpha 1(IV)

SCOPe Domain Sequences for d1li1b2:

Sequence; same for both SEQRES and ATOM records:

>d1li1b2 d.169.1.6 (B:115-229) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]}
amvmavhsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfi
echgrgtcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt

Timeline for d1li1b2:

• d1li1b2 first appeared in SCOP 1.61
  
• d1li1b2 appears in SCOPe 2.02
  
• d1li1b2 appears in SCOPe 2.04
  
• d1li1b2 appears in the current release, SCOPe 2.08