SCOPe 2.05: Domain d1lh0b_: 1lh0 B:

Lineage for d1lh0b_ (1lh0 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Orotate PRTase [53290] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [53291] (3 PDB entries)

8. Domain d1lh0b_: 1lh0 B: [73897]
   complexed with mg, oro, prp

Details for d1lh0b_

PDB Entry: 1lh0, 2 Å

PDB Description: crystal structure of salmonella typhimurium omp synthase in complex with mgprpp and orotate

PDB Compounds: (B:) OMP synthase

SCOPe Domain Sequences for d1lh0b_:

Sequence, based on SEQRES records:

>d1lh0b_ c.61.1.1 (B:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]}
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkeakdhgeggslvgsalqgrv
mlvddvitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvis
iitlkdliayleekpdmaehlaavrayreefgv

Sequence, based on observed residues (ATOM records):

>d1lh0b_ c.61.1.1 (B:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]}
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkegslvgsalqgrvmlvddvi
tagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvisiitlkdl
iayleekpdmaehlaavrayreefgv

Timeline for d1lh0b_:

• d1lh0b_ first appeared in SCOP 1.61
  
• d1lh0b_ appears in SCOPe 2.04
  
• d1lh0b_ appears in SCOPe 2.06
  
• d1lh0b_ appears in the current release, SCOPe 2.08