Lineage for d1lh0a_ (1lh0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863466Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1863651Protein Orotate PRTase [53290] (3 species)
  7. 1863655Species Salmonella typhimurium [TaxId:90371] [53291] (3 PDB entries)
  8. 1863656Domain d1lh0a_: 1lh0 A: [73896]
    complexed with mg, oro, prp

Details for d1lh0a_

PDB Entry: 1lh0 (more details), 2 Å

PDB Description: crystal structure of salmonella typhimurium omp synthase in complex with mgprpp and orotate
PDB Compounds: (A:) OMP synthase

SCOPe Domain Sequences for d1lh0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]}
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkeakdhgeggslvgsalqgrv
mlvddvitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvis
iitlkdliayleekpdmaehlaavrayreefgv

SCOPe Domain Coordinates for d1lh0a_:

Click to download the PDB-style file with coordinates for d1lh0a_.
(The format of our PDB-style files is described here.)

Timeline for d1lh0a_: