Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Orotate PRTase [53290] (3 species) |
Species Salmonella typhimurium [TaxId:90371] [53291] (3 PDB entries) |
Domain d1lh0a_: 1lh0 A: [73896] complexed with mg, oro, prp |
PDB Entry: 1lh0 (more details), 2 Å
SCOPe Domain Sequences for d1lh0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds giefdllfgpaykgipiatttavalaehhdkdlpycfnrkeakdhgeggslvgsalqgrv mlvddvitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvis iitlkdliayleekpdmaehlaavrayreefgv
Timeline for d1lh0a_: