SCOP 1.61: Domain d1lh0a_: 1lh0 A:

Lineage for d1lh0a_ (1lh0 A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)

6. Protein Orotate PRTase [53290] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53291] (3 PDB entries)

8. Domain d1lh0a_: 1lh0 A: [73896]

Details for d1lh0a_

PDB Entry: 1lh0, 2 Å

PDB Description: crystal structure of salmonella typhimurium omp synthase in complex with mgprpp and orotate

SCOP Domain Sequences for d1lh0a_:

Sequence; same for both SEQRES and ATOM records:

>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium}
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkeakdhgeggslvgsalqgrv
mlvddvitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvis
iitlkdliayleekpdmaehlaavrayreefgv

Timeline for d1lh0a_:

• d1lh0a_ is new in SCOP 1.61
  
• d1lh0a_ appears in SCOP 1.63
  
• d1lh0a_ appears in the current release, SCOPe 2.08