Lineage for d1lgqb_ (1lgq B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555727Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 555728Superfamily b.26.1: SMAD/FHA domain [49879] (3 families) (S)
    has a few short helices inserted in loops
  5. 555762Family b.26.1.2: FHA domain [49885] (7 proteins)
  6. 555766Protein Cell cycle checkpoint protein Chfr [74899] (1 species)
  7. 555767Species Human (Homo sapiens) [TaxId:9606] [74900] (2 PDB entries)
  8. 555770Domain d1lgqb_: 1lgq B: [73892]

Details for d1lgqb_

PDB Entry: 1lgq (more details), 2.1 Å

PDB Description: crystal structure of the fha domain of the chfr mitotic checkpoint protein

SCOP Domain Sequences for d1lgqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgqb_ b.26.1.2 (B:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens)}
mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls

SCOP Domain Coordinates for d1lgqb_:

Click to download the PDB-style file with coordinates for d1lgqb_.
(The format of our PDB-style files is described here.)

Timeline for d1lgqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lgqa_