SCOP 1.61: Domain d1lgqb_: 1lgq B:

Lineage for d1lgqb_ (1lgq B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)

4. Superfamily b.26.1: SMAD/FHA domain [49879] (2 families)

5. Family b.26.1.2: FHA domain [49885] (3 proteins)

6. Protein Cell cycle checkpoint protein Chfr [74899] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74900] (2 PDB entries)

8. Domain d1lgqb_: 1lgq B: [73892]

Details for d1lgqb_

PDB Entry: 1lgq, 2.1 Å

PDB Description: crystal structure of the fha domain of the chfr mitotic checkpoint protein

SCOP Domain Sequences for d1lgqb_:

Sequence; same for both SEQRES and ATOM records:

>d1lgqb_ b.26.1.2 (B:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens)}
mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls

Timeline for d1lgqb_:

• d1lgqb_ is new in SCOP 1.61
  
• d1lgqb_ appears in SCOP 1.63
  
• d1lgqb_ appears in the current release, SCOPe 2.08, called d1lgqb1