Lineage for d1lgqb1 (1lgq B:14-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778118Protein Cell cycle checkpoint protein Chfr [74899] (1 species)
  7. 2778119Species Human (Homo sapiens) [TaxId:9606] [74900] (2 PDB entries)
  8. 2778121Domain d1lgqb1: 1lgq B:14-124 [73892]
    Other proteins in same PDB: d1lgqa2, d1lgqb2

Details for d1lgqb1

PDB Entry: 1lgq (more details), 2.1 Å

PDB Description: crystal structure of the fha domain of the chfr mitotic checkpoint protein
PDB Compounds: (B:) cell cycle checkpoint protein CHFR

SCOPe Domain Sequences for d1lgqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgqb1 b.26.1.2 (B:14-124) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]}
qpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqvt
ledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls

SCOPe Domain Coordinates for d1lgqb1:

Click to download the PDB-style file with coordinates for d1lgqb1.
(The format of our PDB-style files is described here.)

Timeline for d1lgqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lgqb2