SCOPe 2.08: Domain d1lgqb1: 1lgq B:14-124

Lineage for d1lgqb1 (1lgq B:14-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein Cell cycle checkpoint protein Chfr [74899] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74900] (2 PDB entries)

8. Domain d1lgqb1: 1lgq B:14-124 [73892]
   Other proteins in same PDB: d1lgqa2, d1lgqb2

Details for d1lgqb1

PDB Entry: 1lgq, 2.1 Å

PDB Description: crystal structure of the fha domain of the chfr mitotic checkpoint protein

PDB Compounds: (B:) cell cycle checkpoint protein CHFR

SCOPe Domain Sequences for d1lgqb1:

Sequence; same for both SEQRES and ATOM records:

>d1lgqb1 b.26.1.2 (B:14-124) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]}
qpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqvt
ledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls

Timeline for d1lgqb1:

• d1lgqb1 first appeared in SCOP 1.61, called d1lgqb_
  
• d1lgqb1 was called d1lgqb_ in SCOPe 2.07