Lineage for d1lgqa_ (1lgq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387735Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387736Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2387783Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2387791Protein Cell cycle checkpoint protein Chfr [74899] (1 species)
  7. 2387792Species Human (Homo sapiens) [TaxId:9606] [74900] (2 PDB entries)
  8. 2387793Domain d1lgqa_: 1lgq A: [73891]

Details for d1lgqa_

PDB Entry: 1lgq (more details), 2.1 Å

PDB Description: crystal structure of the fha domain of the chfr mitotic checkpoint protein
PDB Compounds: (A:) cell cycle checkpoint protein CHFR

SCOPe Domain Sequences for d1lgqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgqa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]}
mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls

SCOPe Domain Coordinates for d1lgqa_:

Click to download the PDB-style file with coordinates for d1lgqa_.
(The format of our PDB-style files is described here.)

Timeline for d1lgqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lgqb_