SCOP 1.71: Domain d1lgqa_: 1lgq A:

Lineage for d1lgqa_ (1lgq A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (3 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (7 proteins)

6. Protein Cell cycle checkpoint protein Chfr [74899] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74900] (2 PDB entries)

8. Domain d1lgqa_: 1lgq A: [73891]

Details for d1lgqa_

PDB Entry: 1lgq, 2.1 Å

PDB Description: crystal structure of the fha domain of the chfr mitotic checkpoint protein

SCOP Domain Sequences for d1lgqa_:

Sequence; same for both SEQRES and ATOM records:

>d1lgqa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens)}
mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls

Timeline for d1lgqa_:

• d1lgqa_ first appeared in SCOP 1.61
  
• d1lgqa_ appears in SCOP 1.69
  
• d1lgqa_ appears in SCOP 1.73
  
• d1lgqa_ appears in the current release, SCOPe 2.08, called d1lgqa1