SCOPe 2.08: Domain d1lg7a_: 1lg7 A:

Lineage for d1lg7a_ (1lg7 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.213: VSV matrix protein [75403] (1 superfamily)
   beta-alpha(2)-beta(4)-alpha-beta(2); two layers: alpha/beta; bifurcated coiled beta-sheet: order of the first 5 strands: 23154

4. Superfamily d.213.1: VSV matrix protein [75404] (2 families)
   automatically mapped to Pfam PF06326

5. Family d.213.1.1: VSV matrix protein [75405] (2 proteins)

6. Protein VSV matrix protein [75406] (1 species)

7. Species Vesicular stomatitis virus, VSV [TaxId:11276] [75407] (1 PDB entry)

8. Domain d1lg7a_: 1lg7 A: [73888]

Details for d1lg7a_

PDB Entry: 1lg7, 1.96 Å

PDB Description: Crystal structure of Vesicular Stomatitis Virus Matrix Protein

PDB Compounds: (A:) VSV matrix protein

SCOPe Domain Sequences for d1lg7a_:

Sequence, based on SEQRES records:

>d1lg7a_ d.213.1.1 (A:) VSV matrix protein {Vesicular stomatitis virus, VSV [TaxId: 11276]}
qlryekffftvkmtvrsnrpfrtysdvaaavshwdhmyigmagkrpfykilaflgssnlk
atpavladqgqpeyhahcegraylphrmgktppmlnvpehfrrpfniglykgtveltmti
yddesleaapmiwdhfnsskfsdfrekalmfglivekkasgawvldsvsh

Sequence, based on observed residues (ATOM records):

>d1lg7a_ d.213.1.1 (A:) VSV matrix protein {Vesicular stomatitis virus, VSV [TaxId: 11276]}
qlryekffftvkmtvrsnrpfrtysdvaaavshwdhmyigmagkrpfykilaflgssnlk
atpaqpeyhahcegraylphrmgktppmlnvpehfrrpfniglykgtveltmtiyddesl
eaapmiwdhfnsskfsdfrekalmfglivekkasgawvldsvsh

Timeline for d1lg7a_:

• d1lg7a_ first appeared in SCOP 1.61
  
• d1lg7a_ appears in SCOPe 2.07