Lineage for d1lg6a_ (1lg6 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (9 species) Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (147 PDB entries) 
Domain d1lg6a_: 1lg6 A: [73887]
Details for d1lg6a_
PDB Entry: 1lg6 (more details), 2.2 Å
PDB Description: crystal structure analysis of hca ii mutant t199p in complex with thiocyanate
SCOP Domain Sequences for d1lg6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lg6a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslptppllesvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk
SCOP Domain Coordinates for d1lg6a_:
Click to download the PDB-style file with coordinates for d1lg6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lg6a_:
- d1lg6a_ is new in SCOP 1.61
- d1lg6a_ appears in SCOP 1.63
- d1lg6a_ appears in the current release, SCOPe 2.08
View in 3D