SCOPe 2.05: Domain d1lfmb_: 1lfm B:

Lineage for d1lfmb_ (1lfm B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
   identical sequence to Thunnus alalunga, TaxId: 8235

8. Domain d1lfmb_: 1lfm B: [73884]
   complexed with coh

Details for d1lfmb_

PDB Entry: 1lfm, 1.5 Å

PDB Description: crystal structure of cobalt(iii)-substituted cytochrome c (tuna)

PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d1lfmb_:

Sequence; same for both SEQRES and ATOM records:

>d1lfmb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d1lfmb_:

• d1lfmb_ first appeared in SCOP 1.61
  
• d1lfmb_ appears in SCOPe 2.04
  
• d1lfmb_ appears in SCOPe 2.06
  
• d1lfmb_ appears in the current release, SCOPe 2.08