SCOPe 2.04: Domain d1lf8b_: 1lf8 B:

Lineage for d1lf8b_ (1lf8 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.2: VHS domain [48468] (6 proteins)

6. Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries)

8. Domain d1lf8b_: 1lf8 B: [73880]
   complexed with peptide from cation-independent mannose 6-phosphate receptor

Details for d1lf8b_

PDB Entry: 1lf8, 2.3 Å

PDB Description: Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide

PDB Compounds: (B:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1lf8b_:

Sequence; same for both SEQRES and ATOM records:

>d1lf8b_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
gsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspq
ewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviell
yswtmalpeeakikdayhmlkrqgivqsdppipvdrtli

Timeline for d1lf8b_:

• d1lf8b_ first appeared in SCOP 1.61
  
• d1lf8b_ appears in SCOPe 2.03
  
• d1lf8b_ appears in SCOPe 2.05
  
• d1lf8b_ appears in the current release, SCOPe 2.08, called d1lf8b1