Lineage for d1lf8b_ (1lf8 B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies) 
Superfamily a.118.9: ENTH/VHS domain [48464] (2 families) 
Family a.118.9.2: VHS domain [48468] (4 proteins) 
Protein Gga3 [69097] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries) 
Domain d1lf8b_: 1lf8 B: [73880]
Details for d1lf8b_
PDB Entry: 1lf8 (more details), 2.3 Å
PDB Description: Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
SCOP Domain Sequences for d1lf8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lf8b_ a.118.9.2 (B:) Gga3 {Human (Homo sapiens)}
gsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspq
ewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviell
yswtmalpeeakikdayhmlkrqgivqsdppipvdrtli
SCOP Domain Coordinates for d1lf8b_:
Click to download the PDB-style file with coordinates for d1lf8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lf8b_:
- d1lf8b_ is new in SCOP 1.61
- d1lf8b_ appears in SCOP 1.63
- d1lf8b_ appears in the current release, SCOPe 2.08, called d1lf8b1
View in 3D
