| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
| Family a.118.9.2: VHS domain [48468] (6 proteins) |
| Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries) |
| Domain d1lf8a_: 1lf8 A: [73879] Other proteins in same PDB: d1lf8b2, d1lf8d2 complexed with peptide from cation-independent mannose 6-phosphate receptor |
PDB Entry: 1lf8 (more details), 2.3 Å
SCOPe Domain Sequences for d1lf8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lf8a_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
esleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqal
tvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalp
eeakikdayhmlkrqgivqsdppipvdrtli
Timeline for d1lf8a_: