Lineage for d1lf1a_ (1lf1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082493Protein Endoglucanase Cel5a [51499] (4 species)
  7. 2082516Species Bacillus subtilis [TaxId:1423] [75068] (1 PDB entry)
  8. 2082517Domain d1lf1a_: 1lf1 A: [73877]

Details for d1lf1a_

PDB Entry: 1lf1 (more details), 1.7 Å

PDB Description: crystal structure of cel5 from alkalophilic bacillus sp.
PDB Compounds: (A:) Cel5

SCOPe Domain Sequences for d1lf1a_:

Sequence, based on SEQRES records: (download)

>d1lf1a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus subtilis [TaxId: 1423]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwgitvfra
amytssggyiddpsvkekvketveaaidlgiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwdnqikpyaeevipvirdndpnnivivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekir

Sequence, based on observed residues (ATOM records): (download)

>d1lf1a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus subtilis [TaxId: 1423]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwgitvfra
amytssggyiddpsvkekvketveaaidlgiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwdnqikpyaeevipvirdndpnnivivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatggvfldea
qvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekir

SCOPe Domain Coordinates for d1lf1a_:

Click to download the PDB-style file with coordinates for d1lf1a_.
(The format of our PDB-style files is described here.)

Timeline for d1lf1a_: