SCOPe 2.03: Domain d1leka2: 1lek A:1-181

Lineage for d1leka2 (1lek A:1-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (41 PDB entries)
   Uniprot P01901 22-299

8. Domain d1leka2: 1lek A:1-181 [73873]
   Other proteins in same PDB: d1leka1, d1lekb_
   complexed with nag, po4

Details for d1leka2

PDB Entry: 1lek, 2.15 Å

PDB Description: crystal structure of h-2kbm3 bound to dev8

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1leka2:

Sequence; same for both SEQRES and ATOM records:

>d1leka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1leka2:

• d1leka2 first appeared in SCOP 1.61
  
• d1leka2 appears in SCOPe 2.02
  
• d1leka2 appears in SCOPe 2.04
  
• d1leka2 appears in the current release, SCOPe 2.08