Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries) Uniprot P01901 22-299 |
Domain d1leka2: 1lek A:1-181 [73873] Other proteins in same PDB: d1leka1, d1lekb_ complexed with nag, po4 |
PDB Entry: 1lek (more details), 2.15 Å
SCOPe Domain Sequences for d1leka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1leka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1leka2: