Lineage for d1legb1 (1leg B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) 
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries) 
Domain d1legb1: 1leg B: [73871]
Other proteins in same PDB: d1lega2
Details for d1legb1
PDB Entry: 1leg (more details), 1.75 Å
PDB Description: crystal structure of h-2kb bound to the dev8 peptide
SCOP Domain Sequences for d1legb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1legb1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOP Domain Coordinates for d1legb1:
Click to download the PDB-style file with coordinates for d1legb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1legb1:
- d1legb1 is new in SCOP 1.61
- d1legb1 is called d1legb_ in SCOP 1.63
- d1legb1 appears in the current release, SCOPe 2.08, called d1legb_
View in 3D
