SCOP 1.73: Domain d1lega2: 1leg A:1-181

Lineage for d1lega2 (1leg A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)

8. Domain d1lega2: 1leg A:1-181 [73870]
   Other proteins in same PDB: d1lega1, d1legb_
   complexed with cso, fuc, nag, po4; mutant

Details for d1lega2

PDB Entry: 1leg, 1.75 Å

PDB Description: crystal structure of h-2kb bound to the dev8 peptide

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1lega2:

Sequence; same for both SEQRES and ATOM records:

>d1lega2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1lega2:

• d1lega2 first appeared in SCOP 1.61
  
• d1lega2 appears in SCOP 1.71
  
• d1lega2 appears in SCOP 1.75
  
• d1lega2 appears in the current release, SCOPe 2.08