Lineage for d1lega2 (1leg A:1-181)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501142Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)
  7. 501301Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries)
  8. 501310Domain d1lega2: 1leg A:1-181 [73870]
    Other proteins in same PDB: d1lega1, d1legb_

Details for d1lega2

PDB Entry: 1leg (more details), 1.75 Å

PDB Description: Crystal Structure of H-2Kb bound to the dEV8 peptide
PDB Compounds: (A:)

SCOP Domain Sequences for d1lega2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lega2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1lega2:

Click to download the PDB-style file with coordinates for d1lega2.
(The format of our PDB-style files is described here.)

Timeline for d1lega2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lega1
View in 3D
Domains from other chains:
(mouse over for more information)
d1legb_