Lineage for d1lega1 (1leg A:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654728Domain d1lega1: 1leg A:182-274 [73869]
    Other proteins in same PDB: d1lega2, d1legb_
    complexed with cso, fuc, nag, po4; mutant

Details for d1lega1

PDB Entry: 1leg (more details), 1.75 Å

PDB Description: crystal structure of h-2kb bound to the dev8 peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1lega1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lega1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1lega1:

Click to download the PDB-style file with coordinates for d1lega1.
(The format of our PDB-style files is described here.)

Timeline for d1lega1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lega2
View in 3D
Domains from other chains:
(mouse over for more information)
d1legb_