SCOPe 2.05: Domain d1le8b_: 1le8 B:

Lineage for d1le8b_ (1le8 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein mat alpha2 Homeodomain [46695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)

8. Domain d1le8b_: 1le8 B: [73868]
   Other proteins in same PDB: d1le8a_
   protein/DNA complex

Details for d1le8b_

PDB Entry: 1le8, 2.3 Å

PDB Description: crystal structure of the mata1/matalpha2-3a heterodimer bound to dna complex

PDB Compounds: (B:) Mating-type protein alpha-2

SCOPe Domain Sequences for d1le8b_:

Sequence; same for both SEQRES and ATOM records:

>d1le8b_ a.4.1.1 (B:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvaarrakektit
iapeladllsgepl

Timeline for d1le8b_:

• d1le8b_ first appeared in SCOP 1.61
  
• d1le8b_ appears in SCOPe 2.04
  
• d1le8b_ appears in SCOPe 2.06
  
• d1le8b_ appears in the current release, SCOPe 2.08