SCOP 1.61: Domain d1le8b_: 1le8 B:

Lineage for d1le8b_ (1le8 B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.1: Homeodomain [46690] (20 proteins)

6. Protein mat alpha2 Homeodomain [46695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (5 PDB entries)

8. Domain d1le8b_: 1le8 B: [73868]
   Other proteins in same PDB: d1le8a_

Details for d1le8b_

PDB Entry: 1le8, 2.3 Å

PDB Description: crystal structure of the mata1/matalpha2-3a heterodimer bound to dna complex

SCOP Domain Sequences for d1le8b_:

Sequence; same for both SEQRES and ATOM records:

>d1le8b_ a.4.1.1 (B:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvaarrakektit
iapeladllsgepl

Timeline for d1le8b_:

• d1le8b_ is new in SCOP 1.61
  
• d1le8b_ appears in SCOP 1.63
  
• d1le8b_ appears in the current release, SCOPe 2.08