SCOP 1.63: Domain d1le8a_: 1le8 A:

Lineage for d1le8a_ (1le8 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (21 proteins)

6. Protein Mating type protein A1 Homeodomain [46693] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries)

8. Domain d1le8a_: 1le8 A: [73867]
   Other proteins in same PDB: d1le8b_
   mutant

Details for d1le8a_

PDB Entry: 1le8, 2.3 Å

PDB Description: crystal structure of the mata1/matalpha2-3a heterodimer bound to dna complex

SCOP Domain Sequences for d1le8a_:

Sequence; same for both SEQRES and ATOM records:

>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
kssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrsk

Timeline for d1le8a_:

• d1le8a_ first appeared in SCOP 1.61
  
• d1le8a_ appears in SCOP 1.65
  
• d1le8a_ appears in the current release, SCOPe 2.08