Lineage for d1le7a_ (1le7 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156745Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 156746Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 156751Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 156752Protein Phospholipase A2 [48637] (4 species)
  7. 156775Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (2 PDB entries)
  8. 156779Domain d1le7a_: 1le7 A: [73865]

Details for d1le7a_

PDB Entry: 1le7 (more details), 2.09 Å

PDB Description: carboxylic ester hydrolase, c 2 2 21 space group

SCOP Domain Sequences for d1le7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le7a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kcd

SCOP Domain Coordinates for d1le7a_:

Click to download the PDB-style file with coordinates for d1le7a_.
(The format of our PDB-style files is described here.)

Timeline for d1le7a_: