SCOP 1.73: Domain d1le6b_: 1le6 B:

Lineage for d1le6b_ (1le6 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Phospholipase A2 [48637] (4 species)

7. Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (2 PDB entries)
   group X secretory phospholipase A2

8. Domain d1le6b_: 1le6 B: [73863]

Details for d1le6b_

PDB Entry: 1le6, 1.97 Å

PDB Description: carboxylic ester hydrolase, p 1 21 1 space group

PDB Compounds: (B:) Group X Secretory Phospholipase A2

SCOP Domain Sequences for d1le6b_:

Sequence; same for both SEQRES and ATOM records:

>d1le6b_ a.133.1.2 (B:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kcd

Timeline for d1le6b_:

• d1le6b_ first appeared in SCOP 1.61
  
• d1le6b_ appears in SCOP 1.71
  
• d1le6b_ appears in SCOP 1.75
  
• d1le6b_ appears in the current release, SCOPe 2.08