![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries) |
![]() | Domain d1ldsa_: 1lds A: [73858] |
PDB Entry: 1lds (more details), 1.8 Å
SCOP Domain Sequences for d1ldsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldsa_ b.1.1.2 (A:) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwd
Timeline for d1ldsa_: