SCOP 1.69: Domain d1ldke1: 1ldk E:3109-3149

Root: SCOP 1.69
Class a: All alpha proteins [46456] (218 folds)
Fold a.158: F-box domain [81385] (1 superfamily)
multihelical; interlocked heterodimer with the Skp1 dimerisation domain
Superfamily a.158.1: F-box domain [81383] (1 family)
Family a.158.1.1: F-box domain [81381] (3 proteins)
Protein Skp2 [81379] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [81377] (4 PDB entries)
Domain d1ldke1: 1ldk E:3109-3149 [73857]
Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

SCOP Domain Sequences for d1ldke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldke1 a.158.1.1 (E:3109-3149) Skp2 {Human (Homo sapiens)}
wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw

SCOP Domain Coordinates for d1ldke1:

Click to download the PDB-style file with coordinates for d1ldke1.
(The format of our PDB-style files is described here.)

Timeline for d1ldke1:

Thumbnails for d1ldke1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2